β-Peptide (1-42) (human)
Name | β-Amyloid (1-42), human l Beta - Amyloid (1 - 42) | |
Type | β-Amyloid Peptide | |
CAS | 107761-42-2 | |
Purity | > 99.0% (HPLC) | |
Pack size | Price ( USD ) | Inventory |
5mg | $ 180.0 | In stock |
50mg | Please Inquire for lowest | In stock |
Omizzur Biotech Online Inquiry Form
Notice:
1.Omizzur follows strict guidelines on the use of private information.
2.For bulk inquiry or custom packaging: [email protected]
3.Our customer service staff will contact you in 1 hour. Please check your email
General Description
Amyloid β (amyloid-β, Aβ) is a peptide containing 39-43 amino acids produced by the proteolysis of amyloid precursor protein (APP) by β- and γ-secretase. It can be produced by a variety of cells and circulate in the blood, cerebrospinal fluid and interstitial fluid. Most of it binds to protein molecules, and a few exist in a free state. The most common subtypes of Aβ in the human body are Aβ1- 40 and Aβ1-42. In human cerebrospinal fluid, the levels of Aβ1- 40 are 10 times higher than those of Aβ1- 42. Aβ1-42 is more toxic and easier to aggregate, forming the core of Aβ precipitation, triggering neurotoxic effects.Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of alzheimer disease.
Alzheimer's disease,AD
Alzheimer's disease (Alzheimer's disease, AD) is a chronic degenerative disease of the central nervous system, which often occurs in pre-age. The main clinical manifestations of AD include progressive memory loss, loss of acquired knowledge, personality changes, and various behavioral and mental disorders such as life and work.
The main pathological features of AD are cerebral cortex atrophy, loss of neurons, senile plaque (SP) formed by the deposition of beta amyloid peptide (Aβ) in the hippocampus, and microtubule-associated protein in brain nerve cells ( Neurofibrillary tangles (NFTs) formed by hyperphosphorylation of tau protein.At present, the amyloid cascade hypothesis is one of the main mechanisms that has been confirmed.
Omizzur supply 98% purity normally .At present, there are two types of monomers and oligomers to supply.
Beta - Amyloid peptide for sale | CAS | Purity (HPLC) | Sequences |
Amyloid β-Protein (1-42) (Human) | 107761-42-2 | 95% / 98% | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGWIA |
Amyloid β-Protein (1-40) | 131438-79-4 | 95% / 98% | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Amyloid β- Protein (25-35) | 131602-53-4 | 95% / 98% | GSNKGAIIGLM |
Amyloid β-Protein (1-28) | 109770-29-8 | 95% / 98% | DAEFRHDSGYEVHHQKLVFFAEDVGSNK |
Amyloid β Protein (1-16) | 131580-10-4 | 95% / 98% | DAEFRHDSGYEVHHQK |
Biotinyl-Amyloid β-Protein (1-40) | 183906-14-1 | 95% / 98% | Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Biotin-β-Amyloid(1-42) | 1802086-20-9 | 95% / 98% | Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
5-FAM-Amyloid β-Protein (1-42) | 1802087-78-0 | 95% / 98% | 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
Product Data Sheet
β-Amyloid (1-42), human
Appearance: Lyophilized white powder
Size: 1mg / 5mg / 10mg,Sub-package available
Peak Area by HPLC : ≥98%
Use 1.0% NH4OH as the solvent, followed by buffer (i.e.1XPBS). Add 1.0% NH4OH directly to the lyophilized peptide powder (add 35-40 μl to 0.5 mg peptide or 70-80 μl to 1 mg peptide).
Comments : Monomer / oligomer (TFA salt )
Shipping & Storage
Shipping: by fedex or DHL, worldwide in 5-7 working days
Shipping: Deliver to worldwide by Fedex / DHL (Free shipping for orders over a certain amount)
Provide with the goods: quality analysis report (COA,MS,HPLC)
Storage: Peptide is shipped at ambient temperature. Upon receipt, store lyophilized powder at –20°C or lower.
Ordering Guide:
1. Please contact us through the 24-hour customer services: [email protected]
2. Please click the “Send inquiry ”button, fill in your product requirements in the form to get in touch with us.
3. Discount policy: Omizzur has regular discount on wholesale quantity.
Customer also viewed
CAS:99896-85-2
Enquiry & Ordering Form
Method 1
Simply email to [email protected] ,you will get a fast response within 1 hour.
Method 2
Submit the simple form to get the latest quotation. Notice:Omizzur follows strict guidelines on the use of private information.
Omizzur Peptide Catalogue
Peptide reagents in stock Download
Customer Service Center
Phone: 400-777-8404
Order: [email protected]
Copyright © 2020 Omizzur Inc | Terms & Conditions | Privacy Notice | Sitemap